Dbfetch

ID   AJ697854; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ697854;
XX
DT   22-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*4022N
DE   allele, exon 4
XX
KW   HLA-B gene; HLA-B*4022N allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (21-APR-2004) to the INSDC.
RL   Dormoy A., Laboratoire HLA, EFS-Alsace, 10 Rue Spielmann, 67 065 Strasbourg
RL   Cedex, FRANCE.
XX
RN   [2]
RA   Dormoy A.;
RT   "The HLA-B*4022N null allele has been found two times in our laboratory";
RL   Unpublished.
XX
DR   MD5; d15ce064b4d6f6d57efab77d9ebbe80a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4022N"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*40:22N"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZXT6"
FT                   /protein_id="CAG26976.1"
FT                   /translation="PPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4022N"
FT                   /number=4
XX
SQ   Sequence 276 BP; 68 A; 83 C; 82 G; 43 T; 0 other;
     accccccaaa gacacacgtg acccaccacc ccatctctga ccatgaggcc accctgaggt        60
     gctgggccct gggtttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//