spacer

EBI Dbfetch

ID   AJ697650; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   AJ697650;
XX
DT   20-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*12 allele,
DE   exons 2-3
XX
KW   HLA-C gene; HLA-Cw*12 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Velickovic Z.;
RT   ;
RL   Submitted (20-APR-2004) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.M.;
RT   "Novel HLA-Cw*12 allele";
RL   Unpublished.
XX
DR   MD5; c692d5e14deee1a5437d9a41726c94ad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6ZXX0"
FT                   /db_xref="IMGT/HLA:C*12:15"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZXX0"
FT                   /protein_id="CAG26753.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGP
FT                   DGRLLRGHDQLAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12"
FT                   /number=3
XX
SQ   Sequence 792 BP; 140 A; 260 C; 287 G; 105 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgccct gagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggccggggc tggggcgggg       480
     ctcgggggac ggggctgacc acgggggcgg ggccagggtc tcacaccctc cagtggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gcatgaccag ttagcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggactgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag tggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer