spacer

EBI Dbfetch

ID   AJ635293; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ635293;
XX
DT   05-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC Class I antigen, HLA-Cw*03 allele,
DE   exon 2 and joined CDS, isolate 217217
XX
KW   HLA-Cw gene; HLA-Cw*03 allele; human leucocyte Cw antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (02-APR-2004) to the INSDC.
RL   Lebedeva T.V., HLA Laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Ohashi M., Huang A., Vasconcellos S., Yu N.;
RT   "Emerging New Alleles Suggest High Diversity of the HLA-C locus.";
RL   Unpublished.
XX
DR   MD5; 530a0dbab2ef753a9a9439d28eec6c2f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="217217"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ635294.1:1..>276)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03"
FT   CDS             join(<1..270,AJ635294.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6ZYC1"
FT                   /db_xref="IMGT/HLA:C*03:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZYC1"
FT                   /protein_id="CAG25671.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03"
FT                   /number=2
XX
SQ   Sequence 270 BP; 53 A; 83 C; 99 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer