Dbfetch

ID   AJ633570; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   AJ633570;
XX
DT   22-MAR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*68 allele,
DE   exons 2-3
XX
KW   HLA-A gene; HLA-A*68 allele; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Velickovic Z.;
RT   ;
RL   Submitted (20-MAR-2004) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.M.;
RT   "Novel HLA-A*68 allele";
RL   Unpublished.
XX
DR   MD5; 57f4e554161acf72c9071c0c137ff691.
DR   EuropePMC; PMC1418621; 16495527.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,511..787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /citation=[2]
FT   CDS             join(<1..270,511..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*68:26"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZZC0"
FT                   /protein_id="CAG17585.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGFSHHPDDVWLRRGV
FT                   GRALPPRVPAGRLRRQGLHRPERGPALLDRGGHGSSDHQAQVGGGPCGGAAESLPGGHV
FT                   RGRAPQIPGEREGDAAAHG"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /number=2
FT   intron          271..510
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /number=2
FT   exon            511..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /number=3
XX
SQ   Sequence 787 BP; 144 A; 254 C; 282 G; 107 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccgc       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggcgggg cggggctcgg       480
     gggaccgggc tgacctcggg gtccgggcca ggttctcaca ccatccagat gatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//