spacer

EBI Dbfetch

ID   AJ632195; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ632195;
XX
DT   17-MAR-2004 (Rel. 79, Created)
DT   10-AUG-2009 (Rel. 101, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*56 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*56 allele; human leucocyte antigen B;
KW   major histocompatability complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Hoppe B.;
RT   ;
RL   Submitted (15-MAR-2004) to the INSDC.
RL   Hoppe B., Institute for Transfusion Medicine, Charite Campus
RL   Virchow-Klinikum, Augustenburger Platz 1, Berlin, 13353, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00306.x.
RX   PUBMED; 15496207.
RA   Hoppe B., Heymann G.A., Schoenemann C., Nagy M., Kiesewetter H., Salama A.;
RT   "Description of a novel HLA-B allele, B*5613, identified during HLA-typing
RT   using sequence-specific oligonucleotide hybridization and sequence-specific
RT   amplification";
RL   Tissue Antigens 64(5):616-618(2004).
XX
DR   MD5; 3dbc079d336042674941fa4f90c45e33.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ632196.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6ZZX3"
FT                   /db_xref="IMGT/HLA:B*56:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZZX3"
FT                   /protein_id="CAG14949.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 85 C; 93 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer