spacer

EBI Dbfetch

ID   AJ629870; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ629870;
XX
DT   04-MAR-2004 (Rel. 79, Created)
DT   18-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-A*29 allele,
DE   exon 2 and joined CDS, isolate 218584
XX
KW   HLA-B gene; HLA-B*3501 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (03-MAR-2004) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Ohashi M., Huang A., Vasconcellos S., Yu N.;
RT   "Identification of novel HLA Class I alleles using single allele
RT   sequencing";
RL   Unpublished.
XX
DR   MD5; ac8cc8b04d39609f217a57c6f5742ea8.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000450342; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
DR   Ensembl-Tr; ENST00000470780; homo_sapiens.
DR   Ensembl-Tr; ENST00000550728; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,AJ629871.1:1..276)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT   CDS             join(<1..270,AJ629871.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q545Z6"
FT                   /db_xref="IMGT/HLA:A*29:02:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Z6"
FT                   /protein_id="CAF33598.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 86 C; 93 G; 37 T; 0 other;
     gctcccactc catgaggtat ttcaccacat ccgtctcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcaccgt ggatagagca ggaggggccg gagtattggg       180
     acctgcagac acggaatgtg aaggcccagt cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer