Dbfetch

ID   AJ629248; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ629248;
XX
DT   03-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partia HLA-B gene for MHC class I antigen, HLA-B*4040 allele,
DE   exon 2 and joined CDS, isolate 32335
XX
KW   HLA-B gene; HLA-B*4040 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (03-MAR-2004) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Clos
RL   Chapelle-aux-Champs, 30 POBox 3052, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "Confirmatory sequence for the HLA B*4040 gene obtained by sequence based
RT   typing";
RL   Unpublished.
XX
DR   MD5; 63a964a7d25575501161827083d2a142.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="32335"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ629249.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*4040"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6KCC4"
FT                   /db_xref="IMGT/HLA:B*40:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6KCC4"
FT                   /protein_id="CAF33267.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="B*4040"
FT                   /number=3
XX
SQ   Sequence 270 BP; 59 A; 86 C; 88 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//