spacer

EBI Dbfetch

ID   AJ627279; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ627279;
XX
DT   11-MAY-2004 (Rel. 79, Created)
DT   28-JUL-2009 (Rel. 101, Last updated, Version 5)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*11 allele,
DE   exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*11 allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (10-FEB-2004) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00289.x.
RX   PUBMED; 15304012.
RA   Poli F., Crespiatico L., Frison S., Andreini E., Ferrioli G., Rossi U.,
RA   Poli F.;
RT   "Description of a new HLA-DRB1 allele, DRB1*1150";
RL   Tissue Antigens 64(3):298-299(2004).
XX
DR   MD5; a4e6947bbd953177540469138ce5941b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q702H0"
FT                   /db_xref="IMGT/HLA:DRB1*11:50"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q702H0"
FT                   /protein_id="CAF28459.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYARFDSDVGEYRAV
FT                   RELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer