spacer

EBI Dbfetch

ID   AJ621243; SV 1; linear; genomic DNA; STD; HUM; 3109 BP.
XX
AC   AJ621243;
XX
DT   17-FEB-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*0201V allele, exons
DE   1-8
XX
KW   HLA-A gene; HLA-A*0201V allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3109
RA   Cox S.T.;
RT   ;
RL   Submitted (16-JAN-2004) to the INSDC.
RL   Cox S.T., HLA Sequencing, Anthony Nolan Research Institute, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "New HLA allele, HLA-A*02XX";
RL   Unpublished.
XX
DR   MD5; 74777150832f351162301c7d04a64d48.
XX
CC   Related entry AJ555412
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3109
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2871..2875)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presetation"
FT                   /db_xref="GOA:Q704F3"
FT                   /db_xref="IMGT/HLA:A*02:68"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q704F3"
FT                   /protein_id="CAF18417.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLKAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=2
FT   intron          474..714
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=3
FT   variation       913
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201"
FT                   /replace="g"
FT   intron          991..1590
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=3
FT   exon            1591..1866
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=4
FT   intron          1867..1965
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=4
FT   exon            1966..2082
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=5
FT   intron          2083..2520
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=5
FT   exon            2521..2553
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=6
FT   intron          2554..2695
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=6
FT   exon            2696..2743
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=7
FT   intron          2744..2870
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=7
FT   exon            2871..>2875
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=8
XX
SQ   Sequence 3109 BP; 604 A; 884 C; 957 G; 664 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaac       120
     gggcccgcct ggcgggggcg caggacccgg gaagccgcgc cgggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctctca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggt ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac       420
     tcaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccaggtt       660
     ggtcggggcg gggcggggct cgggggaccg ggctgaccgc ggggtccggg ccaggttctc       720
     acaccgtcca gaggatgtat ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       900
     cggagcagtt gaaagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1260
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1320
     caatgtgtgt gggggtctga gtccagcact tctgagtcct tcagcctcca ctcaggtcag      1380
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1440
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1500
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1560
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1620
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1740
     ccaggcctgc aggggatgga accttccaga agtgggcggc tgtggtggtg ccttctggac      1800
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      1860
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1920
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      1980
     ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcactg      2040
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa ggggtgaagg      2100
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2160
     cctcgttact gggaagcacc acccacaatt atgggcctac ccagcctggg ccctgtgtgc      2220
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2280
     acagcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2340
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcccgc      2400
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2460
     tctaggacct taaggccctg actcctttct ggtatctcac aggacatttt cttcccacag      2520
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2580
     ggtccttggg atattgtgtt tgggagccca tgggggagct cacccacccc acaattcctc      2640
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgttctac cccaggcagt      2700
     gacagtgccc agggctctga tgtgtctctc acagcttgta aaggtgagag cctggagggc      2760
     ctgatgtgtg ttgggtgttg ggcggaacag tggacacagc tgtgctatgg ggtttctttc      2820
     cattggatgt attgagcatg cgatgggctg tttaaagtgt gacccctcac tgtgacagat      2880
     acgaatttgt tcatgaatat ttttttctat agtgtgagac agctgccttg tgtgggactg      2940
     agaggcaaga gttgttcctg cccttccctt tgtgacttga agaaccctga ctttgtttct      3000
     gcaaaggcac ctgcatgtgt ctgtgttcgt gtaggcataa tgtgaggagg tggggagacc      3060
     accccacccc catgtccacc atgaccctct tcccacgctg acctgtgct                  3109
//


spacer
spacer