spacer

EBI Dbfetch

ID   AJ620474; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ620474;
XX
DT   09-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*1505 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*1505 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Bendukidze N.;
RT   ;
RL   Submitted (08-JAN-2004) to the INSDC.
RL   Bendukidze N., H and I DNA Reference Laboratory, National Blood Service,
RL   Southmead Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Bendukidze N., Poles A.;
RT   "Confirmatory sequence for HLA-B*1505 allele";
RL   Unpublished.
XX
DR   MD5; 7656ac2e85e62e6672c8813119d115ad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1505"
FT                   /number=2
FT   CDS             join(<1..270,AJ620475.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1505"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q704Y5"
FT                   /db_xref="IMGT/HLA:B*15:05:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q704Y5"
FT                   /protein_id="CAF05628.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 270 BP; 58 A; 88 C; 88 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer