spacer

EBI Dbfetch

ID   AJ616764; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ616764;
XX
DT   15-DEC-2003 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, HLA-Cw*04 allele,
DE   exon 2 and joined CDS, isolate 214450
XX
KW   HLA-Cw gene; HLA-Cw*04 allele; human leucocyte antigen Cw;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (03-DEC-2003) to the INSDC.
RL   Lebedeva T.V., HLA Laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Ohashi M., Huang A., Vasconcellos S., Yu N.;
RT   "Novel HLA-Cw alleles identified by single allele sequencing";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="214450"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ616765.1:1..>276)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04"
FT   CDS             join(<1..270,AJ616765.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q708F4"
FT                   /db_xref="IMGT/HLA:C*04:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q708F4"
FT                   /protein_id="CAE84097.2"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 80 C; 98 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer