spacer

EBI Dbfetch

ID   AJ607425; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ607425;
XX
DT   20-NOV-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*0809 allele, exon 4
XX
KW   HLA-B gene; HLA-B*0809 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Ulrich S.;
RT   ;
RL   Submitted (19-NOV-2003) to the INSDC.
RL   Ulrich S., Blood Group Serology and Transfusion med, University of Graz,
RL   Auenbruggerplatz 3, 8036 Graz, AUSTRIA.
XX
RN   [2]
RA   Ulrich S., Posch U., Lanzer G.;
RT   "Exon 4 sequence of HLA-B*0809";
RL   Unpublished.
XX
DR   MD5; 500d9f29759f49892bbc2c6beb5dbe0b.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
DR   Ensembl-Tr; ENST00000416726; homo_sapiens.
DR   Ensembl-Tr; ENST00000418147; homo_sapiens.
DR   Ensembl-Tr; ENST00000425798; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="ANO"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0809"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*08:09"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q709M5"
FT                   /protein_id="CAE55199.1"
FT                   /translation="PPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0809"
FT                   /number=4
XX
SQ   Sequence 276 BP; 68 A; 84 C; 82 G; 42 T; 0 other;
     accccccaaa gacacacgtg acccaccacc ccatctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//


spacer
spacer