Dbfetch

ID   AJ606948; SV 1; linear; genomic DNA; STD; HUM; 859 BP.
XX
AC   AJ606948;
XX
DT   18-NOV-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*3541 allele,
DE   exons 2-3, sample id 41405
XX
KW   HLA-B gene; HLA-B*3541 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-859
RA   Hammond L.;
RT   ;
RL   Submitted (17-NOV-2003) to the INSDC.
RL   Hammond L., Molecular Genetics, Welsh Blood Service, Ely Valley Road,
RL   Pontyclun, Talbot Green CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Darke C., Hammond L., Street J., Downing J.;
RT   "Confirmatory sequence of HLA B*3541";
RL   Unpublished.
XX
DR   MD5; 469b788264b9d5c5cb87c13e23afbd21.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..859
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="sample id 41405"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="buffy coat"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<16..285,531..>806)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*35:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q709P9"
FT                   /protein_id="CAE54963.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSACDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            16..285
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /number=2
FT   intron          286..530
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /number=2
FT   exon            531..806
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /number=3
XX
SQ   Sequence 859 BP; 150 A; 290 C; 302 G; 117 T; 0 other;
     cctcctcgcc cccaggctcc cactccatga ggtatttcta caccgccatg tcccggcccg        60
     gccgcgggga gccccgcttc atcgcagtgg gctacgtgga cgacacccag ttcgtgaggt       120
     tcgacagcga cgccgcgagt ccgaggacgg agccccgggc gccatggata gagcaggagg       180
     ggccggagta ttgggaccgg aacacacaga tcttcaagac caacacacag acttaccgag       240
     agagcctgcg gaacctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc       300
     ccggggcgca ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc       360
     gggtccgaga tccgcctccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag       420
     ccccaggcgc gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc       480
     ggggcggggc ggggctcggg ggacggggct gaccgcgggg ccggggccag ggtctcacat       540
     catccagagg atgtatggct gcgacctggg gcccgacggg cgcctcctcc gcgggcatga       600
     ccagtccgcc tgcgacggca aggattacat cgccctgaac gaggacctga gctcctggac       660
     cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga       720
     gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat acctggagaa       780
     cgggaaggag acgctgcagc gcgcgggtac caggggcagt ggggagcctt ccccatctcc       840
     tataggtcgc cggggatgg                                                    859
//