Dbfetch

ID   AJ606947; SV 1; linear; genomic DNA; STD; HUM; 865 BP.
XX
AC   AJ606947;
XX
DT   18-NOV-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*3541 allele,
DE   exons 2-3, sample id 40795
XX
KW   HLA-B gene; HLA-B*3541 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-865
RA   Hammond L.;
RT   ;
RL   Submitted (17-NOV-2003) to the INSDC.
RL   Hammond L., Dept. of Molecular Genetics, Welsh Blood Service, Ely Valley
RL   Road, Pontyclun, Talbot Green CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Darke C., Hammond L., Street J., Downing J.;
RT   "Confirmatory sequence of HLA B*3541";
RL   Unpublished.
XX
DR   MD5; 565834559cd0c19b311acb6c0f627ef8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..865
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="sample id 40795"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="buffy coat"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<4..273,519..>794)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation molecule"
FT                   /db_xref="IMGT/HLA:B*35:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q709Q0"
FT                   /protein_id="CAE54962.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSACDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            4..273
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /number=2
FT   intron          274..518
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /number=2
FT   exon            519..794
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3541"
FT                   /number=3
XX
SQ   Sequence 865 BP; 156 A; 287 C; 306 G; 116 T; 0 other;
     caggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc        60
     cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg       120
     ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg ccggagtatt       180
     gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag agcctgcgga       240
     acctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg       300
     tcacgactcc ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc       360
     cgcctccctg aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt       420
     ttacccggtt tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg       480
     ggctcggggg acggggctga ccgcggggcc ggggccaggg tctcacatca tccagaggat       540
     gtatggctgc gacctggggc ccgacgggcg cctcctccgc gggcatgacc agtccgcctg       600
     cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg cggcggacac       660
     cgcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc agctgagagc       720
     ctacctggag ggcctgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac       780
     gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctccta taggtcgccg       840
     gggatggcct cccacgagaa gagga                                             865
//