spacer

EBI Dbfetch

ID   AJ606930; SV 1; linear; genomic DNA; STD; HUM; 288 BP.
XX
AC   AJ606930;
XX
DT   31-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial MICB gene, new allele MICB*H0150101, exon 3
XX
KW   MICB protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-288
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-NOV-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, 30625 Hannover, GERMANY.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2004.00286.x.
RX   PUBMED; 15304008.
RA   Schroeder M., Elsner H.A., Kim T.D., Blasczyk R.;
RT   "Eight novel MICB alleles, including a null allele, identified in gastric
RT   MALT lymphoma patients";
RL   Tissue Antigens 64(3):276-280(2004).
XX
DR   MD5; c1510bd953ce6eff4d0cd8d8d8a6c16d.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AJ606930.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..288
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="MALT lymphoma patient"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>288
FT                   /gene="MICB"
FT                   /allele="MICB*H0150101"
FT   CDS             <1..>288
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /allele="MICB*H0150101"
FT                   /product="MICB protein"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*022"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="CAE54956.1"
FT                   /translation="LHSLQEIRVCEIHEDSSTRGSRHFYYNGELFLSQNLETQESTVPQ
FT                   SSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRT"
FT   exon            1..288
FT                   /gene="MICB"
FT                   /allele="MICB*H0150101"
FT                   /number=3
XX
SQ   Sequence 288 BP; 81 A; 80 C; 72 G; 55 T; 0 other;
     gcttgcattc cctccaggag attagggtct gtgagatcca tgaagacagc agcaccaggg        60
     gctcccggca tttctactac aatggggagc tcttcctctc ccaaaacctg gagactcaag       120
     aatcgacagt gccccagtcc tccagagctc agaccttggc tatgaacgtc acaaatttct       180
     ggaaggaaga tgccatgaag accaagacac actatcgcgc tatgcaggca gactgcctgc       240
     agaaactaca gcgatatctg aaatccgggg tggccatcag gagaacag                    288
//


spacer
spacer