spacer

EBI Dbfetch

ID   AJ606926; SV 1; linear; genomic DNA; STD; HUM; 254 BP.
XX
AC   AJ606926;
XX
DT   31-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial MICB gene, new allele MICB*H0140101N, exon 2
XX
KW   MICB protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-254
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-NOV-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, 30625 Hannover, GERMANY.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2004.00286.x.
RX   PUBMED; 15304008.
RA   Schroeder M., Elsner H.A., Kim T.D., Blasczyk R.;
RT   "Eight novel MICB alleles, including a null allele, identified in gastric
RT   MALT lymphoma patients";
RL   Tissue Antigens 64(3):276-280(2004).
XX
DR   MD5; 23e4737927d9dd68a03f1480132b68cc.
DR   IMGT/LIGM; AJ606926.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..254
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="MALT lymphoma patient"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..197
FT                   /gene="MICB"
FT                   /allele="MICB*H0150101N"
FT   CDS             <1..197
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /allele="MICB*H0140101N"
FT                   /product="MICB protein"
FT                   /db_xref="IMGT/HLA:MICB*021N"
FT                   /protein_id="CAE54952.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPR
FT                   DSGQKMSWELRPGTQRPRT"
FT   exon            1..197
FT                   /gene="MICB"
FT                   /allele="MICB*H0140101N"
FT                   /number=2
XX
SQ   Sequence 254 BP; 68 A; 64 C; 79 G; 43 T; 0 other;
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       120
     gcagggcaaa gcccagggac agtgggcaga agatgtcctg ggagctaaga cctgggacac       180
     agagaccgag gacttgacag agaatgggca agacctcagg aggaccctga ctcatatcaa       240
     ggaccagaaa ggag                                                         254
//


spacer
spacer