spacer

EBI Dbfetch

ID   AJ606920; SV 1; linear; genomic DNA; STD; HUM; 279 BP.
XX
AC   AJ606920;
XX
DT   31-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial MICB gene, new allele MICB*H0200101, exon 4
XX
KW   MICB protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-279
RA   Blasczyk R.;
RT   ;
RL   Submitted (17-NOV-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, 30625 Hannover, GERMANY.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2004.00286.x.
RX   PUBMED; 15304008.
RA   Schroeder M., Elsner H.A., Kim T.D., Blasczyk R.;
RT   "Eight novel MICB alleles, including a null allele, identified in gastric
RT   MALT lymphoma patients";
RL   Tissue Antigens 64(3):276-280(2004).
XX
DR   MD5; bd8ba8b766bbbed95ddb0a9ebf1f560a.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AJ606920.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..279
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="MALT lymphoma patient"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>279
FT                   /gene="MICB"
FT                   /allele="MICB*H0200101"
FT   CDS             <1..>279
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /allele="MICB*H0200101"
FT                   /product="MICB protein"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*019"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="CAE54946.1"
FT                   /translation="PPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNT
FT                   QQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPS"
FT   exon            1..279
FT                   /gene="MICB"
FT                   /allele="MICB*H0200101"
FT                   /number=4
XX
SQ   Sequence 279 BP; 64 A; 83 C; 81 G; 51 T; 0 other;
     tgccccccat ggtgaatgtc acctgcagcg aggtctcaga gggcaacatc accgtgacat        60
     gcagggcttc cagcttctat ccccggaata tcacactgac ctggcgtcag gatggggtat       120
     ctttgagcca caacacccag cagtgggggg atgtcctgcc tgatgggaat ggaacctacc       180
     agacctgggt ggccaccagg attcgccaag gagaggagca gaggttcacc tgctacatgg       240
     aacacagcgg gaatcacggc actcaccctg tgccctctg                              279
//


spacer
spacer