spacer

EBI Dbfetch

ID   AJ606906; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   AJ606906;
XX
DT   31-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial MICB gene, new allele MICB*H0160101, exon 2
XX
KW   MICB protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RA   Blasczyk R.;
RT   ;
RL   Submitted (17-NOV-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, 30625 Hannover, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00286.x.
RX   PUBMED; 15304008.
RA   Schroeder M., Elsner H.A., Kim T.D., Blasczyk R.;
RT   "Eight novel MICB alleles, including a null allele, identified in gastric
RT   MALT lymphoma patients";
RL   Tissue Antigens 64(3):276-280(2004).
XX
DR   MD5; 99676dbb59ece8c727ba4da22a6f05a1.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AJ606906.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="MALT lymphoma patient"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>255
FT                   /gene="MICB"
FT                   /allele="MICB*H0160101"
FT   CDS             <1..>255
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /allele="MICB*H0160101"
FT                   /product="MICB protein"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*016"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="CAE54932.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKG"
FT   exon            1..255
FT                   /gene="MICB"
FT                   /allele="MICB*H0160101"
FT                   /number=2
XX
SQ   Sequence 255 BP; 67 A; 65 C; 80 G; 43 T; 0 other;
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctgag acctgggaca       180
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       240
     aggaccagaa aggag                                                        255
//


spacer
spacer