spacer

EBI Dbfetch

ID   AJ604535; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ604535;
XX
DT   28-OCT-2003 (Rel. 77, Created)
DT   07-SEP-2010 (Rel. 106, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*23 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-A gene; HLA-A*23 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Bengtsson M.;
RT   ;
RL   Submitted (27-OCT-2003) to the INSDC.
RL   Bengtsson M., Oncology, Radiology and Clin Immunology, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, S-751 85 Uppsala,
RL   SWEDEN.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00639.x.
RX   PUBMED; 16866890.
RA   Hammond L., Bengtsson M., Street J., Pepperall J., Darke C.;
RT   "HLA-A*2312--a novel allele found during testing for the UK NEQAS for H&I
RT   DNA HLA-typing scheme";
RL   Tissue Antigens 68(2):175-176(2006).
XX
DR   MD5; 2e375dc5b4342d4e43f72bd3fb560f7f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ604536.1:1..>276)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23"
FT   CDS             join(<1..270,AJ604536.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q70BE5"
FT                   /db_xref="IMGT/HLA:A*23:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q70BE5"
FT                   /protein_id="CAE53175.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTHRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 85 C; 94 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactca ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer