Dbfetch

ID   AJ581839; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ581839;
XX
DT   04-SEP-2003 (Rel. 77, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*11 variant
DE   allele, exon 3
XX
KW   HLA-A gene; HLA-A*11 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Day S.;
RT   ;
RL   Submitted (02-SEP-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00511.x.
RX   PUBMED; 16441487.
RA   Bendukidze N., Day S., Street J., Hammond L., Downing J., Corbin S.,
RA   Dunn P.P., Darke C.;
RT   "Identification of a novel HLA-A allele (A*1115) in the UK National
RT   External Quality Assessment Schemes for Histocompatibility and
RT   Immunogenetics' Educational Cell Exchange";
RL   Tissue Antigens 67(2):153-156(2006).
XX
DR   MD5; e58728cf4e32081e0d030f99a895301d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant allele"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*11:15:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q70GH1"
FT                   /protein_id="CAE46482.1"
FT                   /translation="SHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
FT                   DMAAQITKRKWEAAHAAEQQRAYLEGRCLEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 276 BP; 57 A; 82 C; 100 G; 37 T; 0 other;
     gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg cgcttcctcc        60
     gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgcggcgga gcagcagaga gcctacctgg agggccggtg cctggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//