Dbfetch

ID   AJ581838; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ581838;
XX
DT   04-SEP-2003 (Rel. 77, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*11 variant
DE   allele, exon 2
XX
KW   HLA-A gene; HLA-A*11 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Day S.;
RT   ;
RL   Submitted (02-SEP-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00511.x.
RX   PUBMED; 16441487.
RA   Bendukidze N., Day S., Street J., Hammond L., Downing J., Corbin S.,
RA   Dunn P.P., Darke C.;
RT   "Identification of a novel HLA-A allele (A*1115) in the UK National
RT   External Quality Assessment Schemes for Histocompatibility and
RT   Immunogenetics' Educational Cell Exchange";
RL   Tissue Antigens 67(2):153-156(2006).
XX
DR   MD5; 82b73726b734896ef6b4364dcdc6309c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant allele"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*11:15:01"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q70GH2"
FT                   /protein_id="CAE46481.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSED"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
XX
SQ   Sequence 270 BP; 53 A; 83 C; 97 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//