spacer

EBI Dbfetch

ID   AJ581747; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ581747;
XX
DT   02-SEP-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA DRB1 gene for MHC class II antigen, HLA-DRB1*01
DE   new allele, exon 2
XX
KW   HLA DRB1 gene; HLA-DRB1*01 new allele; major histocompatibility complex;
KW   MHC class I antigen; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Bengtsson M.;
RT   ;
RL   Submitted (01-SEP-2003) to the INSDC.
RL   Bengtsson M., Oncology, Radiology and Clin Immunology, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, S-751 85 Uppsala,
RL   SWEDEN.
XX
RN   [2]
RA   Egle Jansson I., Persson U., Kaellsten K., Bengtsson M.;
RT   "Description of a new DRB1*01 allele";
RL   Unpublished.
XX
DR   MD5; 489d1b0796ab228195a582ffbedf8f5e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA DRB1"
FT                   /allele="HLA-DRB1*01 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q546B9"
FT                   /db_xref="IMGT/HLA:DRB1*01:11:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q546B9"
FT                   /protein_id="CAE46444.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA DRB1"
FT                   /allele="DRB1*01 new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 60 C; 99 G; 52 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer