Dbfetch

ID   AJ581659; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AJ581659;
XX
DT   01-SEP-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*74 allele,
DE   exons 2-3
XX
KW   HLA-A gene; HLA-A*74 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Smillie D.;
RT   ;
RL   Submitted (29-AUG-2003) to the INSDC.
RL   Smillie D., Histocompatibility, National Blood Service, Longley Lane,
RL   Sheffield, S5 7JN, UNITED KINGDOM.
XX
RN   [2]
RA   Smillie D., Collins N., Roche L., Harmer A.;
RT   "Identification of a new HLA-A*74 allele";
RL   Unpublished.
XX
DR   MD5; d9b572eaed8b976f765a51550b0c28b4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..546
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*74:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q70GP5"
FT                   /protein_id="CAE46395.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQMMYGCDVGP
FT                   DGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74"
FT                   /number=2
FT   exon            271..546
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74"
FT                   /number=3
XX
SQ   Sequence 546 BP; 108 A; 163 C; 197 G; 78 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg gttctcacac catccagatg atgtatggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggtacca gcaggacgcc tacgacggca       360
     aggattacat cgccttgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//