spacer

EBI Dbfetch

ID   AJ581459; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ581459;
XX
DT   21-NOV-2003 (Rel. 77, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for HLA class I antigen, allele HLA-B*18,
DE   exon 4
XX
KW   HLA-B gene; HLA-B*18 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Poli F.;
RT   ;
RL   Submitted (21-AUG-2003) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.0001-2815.2004.00216.x.
RX   PUBMED; 15140039.
RA   Frison S., Crespiatico L., Longhi E., Guizzardi E., Poli F., Scalamogna M.;
RT   "HLA-B*1819, a novel HLA-B allele identified by sequence-based typing";
RL   Tissue Antigens 63(6):592-594(2004).
XX
DR   MD5; 32d7c44dafe7b3bbb0bdb49708683b3d.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
DR   Ensembl-Tr; ENST00000416726; homo_sapiens.
DR   Ensembl-Tr; ENST00000418147; homo_sapiens.
DR   Ensembl-Tr; ENST00000425798; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /cell_type="B lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*18:19"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q70HJ6"
FT                   /protein_id="CAE46177.1"
FT                   /translation="PPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /number=4
XX
SQ   Sequence 276 BP; 68 A; 84 C; 82 G; 42 T; 0 other;
     accccccaaa gacacatgtg acccaccacc ccatctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacaccgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//


spacer
spacer