spacer

EBI Dbfetch

ID   AJ581457; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ581457;
XX
DT   21-NOV-2003 (Rel. 77, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for HLA class I antigen, allele HLA-B*18,
DE   exon 2
XX
KW   HLA-B gene; HLA-B*18 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (21-AUG-2003) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.0001-2815.2004.00216.x.
RX   PUBMED; 15140039.
RA   Frison S., Crespiatico L., Longhi E., Guizzardi E., Poli F., Scalamogna M.;
RT   "HLA-B*1819, a novel HLA-B allele identified by sequence-based typing";
RL   Tissue Antigens 63(6):592-594(2004).
XX
DR   MD5; bf7bdf672939d1f98750647d48743d29.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   Ensembl-Tr; ENST00000479203; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /cell_type="B lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q70HJ8"
FT                   /db_xref="IMGT/HLA:B*18:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q70HJ8"
FT                   /protein_id="CAE46175.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 90 C; 86 G; 36 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer