spacer

EBI Dbfetch

ID   AJ581083; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ581083;
XX
DT   28-AUG-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*07 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*07 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Bengtsson M.;
RT   ;
RL   Submitted (26-AUG-2003) to the INSDC.
RL   Bengtsson M., Oncology, Radiology and Clin. Immunology, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, S-751 85 Uppsala,
RL   SWEDEN.
XX
RN   [2]
RA   Baeckstroem G., Egle-Jansson I., Kaellsten K., Bengtsson M.;
RT   "Identification of a new HLA B7 allele with a Bw4 motif";
RL   Unpublished.
XX
DR   MD5; 1a3626779c2bcc69548c24bcb2ef91c1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ581084.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q70HQ8"
FT                   /db_xref="IMGT/HLA:B*07:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q70HQ8"
FT                   /protein_id="CAE46087.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRENLRIALRYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 87 C; 89 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer