spacer

EBI Dbfetch

ID   AJ580912; SV 1; linear; genomic DNA; STD; HUM; 73 BP.
XX
AC   AJ580912;
XX
DT   30-AUG-2003 (Rel. 77, Created)
DT   10-AUG-2009 (Rel. 101, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*81 allele,
DE   exon 1 and joined CDS
XX
KW   HLA-B gene; HLA-B*81 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-73
RA   Fischer G.F.;
RT   ;
RL   Submitted (19-AUG-2003) to the INSDC.
RL   Fischer G.F., Department for Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20 A-1090 Vienna, A-1090, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00323.x.
RX   PUBMED; 15496205.
RA   Fae I., Lau M., Voorter C., Mayr W.R., Fischer G.F.;
RT   "HLA-B*8102*, a new allele found in an external proficiency testing
RT   scheme";
RL   Tissue Antigens 64(5):608-610(2004).
XX
DR   MD5; 55495506f7907614ac9c2278247a39fd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..73
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="protocol SJ220/09"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="mononuclear cells"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,AJ580913.1:1..270,AJ580914.1:1..>276)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*81"
FT   CDS             join(1..73,AJ580913.1:1..270,AJ580914.1:1..>276)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*81"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q70I17"
FT                   /db_xref="IMGT/HLA:B*81:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q70I17"
FT                   /protein_id="CAE46109.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*81"
FT                   /number=1
XX
SQ   Sequence 73 BP; 7 A; 30 C; 23 G; 13 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccg                                                           73
//


spacer
spacer