Dbfetch

ID   AJ580805; SV 1; linear; genomic DNA; STD; HUM; 1916 BP.
XX
AC   AJ580805;
XX
DT   25-AUG-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial MICA gene for MHC class I polypeptide-related protein
DE   A, MICA*0112*00701recomb allele, exons 2-5
XX
KW   MHC class I polypeptide-related protein A; MICA gene;
KW   MICA*0112*00701recomb allele.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1916
RA   Quiroga I.;
RT   ;
RL   Submitted (08-AUG-2003) to the INSDC.
RL   Quiroga I., Nuffield Department of Surgery, University of Oxford, Tissue
RL   Typing Lab. Churchill Hospital, Old Road, Headington, Oxford, OX3 7LJ,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00574.x.
RX   PUBMED; 16634869.
RA   Quiroga I., Sweeney D., Sutton M., Ahmad T., Walton R., Barnardo M.,
RA   Fuggle S.V.;
RT   "The identification of three novel MICA alleles by sequence-based typing";
RL   Tissue Antigens 67(4):321-325(2006).
XX
DR   MD5; f7ab115315422c44ee0b223bb652565d.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AJ580805.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1916
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="patient identifier: U180"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..256,531..818,1406..1684,1785..>1916)
FT                   /codon_start=1
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /product="MHC class I polypeptide-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*018:02"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="CAE45581.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVS
FT                   LSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQ
FT                   SHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   exon            1..256
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /number=2
FT   intron          257..530
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /number=2
FT   exon            531..818
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /number=3
FT   intron          819..1405
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /number=3
FT   exon            1406..1684
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /number=4
FT   intron          1685..1784
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /number=4
FT   exon            1785..1916
FT                   /gene="MICA"
FT                   /allele="MICA*0112*00701recomb"
FT                   /number=5
XX
SQ   Sequence 1916 BP; 437 A; 505 C; 577 G; 397 T; 0 other;
     gagccccaca gtcttcgtta taacctcacg gtgctgtcct gggatggatc tgtgcagtca        60
     gggtttctca ctgaggtaca tctggatggt cagcccttcc tgcgctgtga caggcagaaa       120
     tgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggaaataa gacatgggac       180
     agagagacca gagacttgac agggaacgga aaggacctca ggatgaccct ggctcatatc       240
     aaggaccaga aagaaggtga gagtcggcag gggcaagagt gactggagag gccttttcca       300
     gaaaagttag gggcagagag cagggacctg tctcttccca ctggatctgg ctcaggctgg       360
     gggtgaggaa tgggggtcag tggaactcag cagggtggtg agccggcact cagcccacac       420
     agggaggcat ggaggagggc cagggaggcg taccccctgg gctgagttcc tcacttgggt       480
     ggaaaggtga tgggttcggg aatggagaag tcactgctgg gtgggggcag gcttgcattc       540
     cctccaggag attagggtct gtgagatcca tgaagacaac agcaccagga gctcccagca       600
     tttctactac gatggggagc tcttcctctc ccaaaacctg gagactgagg aatggacaat       660
     gccccagtcc tccagagctc agaccttggc catgaacgtc aggaatttct tgaaggaaga       720
     tgccatgaag accaagacac actatcacgc tatgcatgca gactgcctgc aggaactacg       780
     gcgatatcta aaatccggcg tagtcctgag gagaacaggt accgacgctg gccaggggct       840
     ctcctctccc tccaattctg ctagagttgc ctcacctccc agatgtgtcc agggaaaccc       900
     tccctgtgct atggatgaag gcatttcctg ttggcacatc gtgtcctgat tttcctctat       960
     tgttagagcc actggataaa gacagtgggt cagggactgg accatccagt gttgtaatca      1020
     gggcaagtag aggaccctcc gacagaatcc tgagcctggg gtgggtgtca ggcaggagag      1080
     gaaggcttca gggccagggc tgccccctct gcctcccagc ctgcccatcc tggagagttc      1140
     cctcctggcc ccacaaccca ggagtccacc cctgacatcc ccctcctcag catcaatgtg      1200
     gggatcccag agcctgaggc cacagtccca tggcccatcc tcctgccagc ctggaagaac      1260
     tgggccccag agtgaggaca gacttgcagg tcaggggtcc cagagggctt cagccagagt      1320
     gagaacagtg aagagaaaca gccctgttcc tctcccctcc ttagagggga gcagggcttc      1380
     actggctctg ccctttcttc tccagtgccc cccatggtga atgtcacccg cagtgaggcc      1440
     tcagagggca acattaccgt gacatgcagg gcttctggct tctatccctg gaatatcaca      1500
     ctgagctggc gtcaggatgg ggtatctttg agccacgaca cccagcagtg gggggatgtc      1560
     ctgcctgatg ggaatggaac ctaccagacc tgggtggcca ccaggatttg ccaaggagag      1620
     gagcagaggt tcacctgcta catggaacac agcgggaatc acagcactca ccctgtgccc      1680
     tctggtgagc ctagggtgac cctggagagg gtcaggccag ggtagggaca gcagggatgg      1740
     ctgtggctct ctgcccagtg tataacaagt cccttttttt tcagggaaag tgctggtgct      1800
     tcagagtcat tggcagacat tccatgtttc tgctgttgct gctgctgcta tttttgttat      1860
     tattattttc tatgtccgtt gttgtaagaa gaaaacatca gctgcagagg gtccag          1916
//