Dbfetch

ID   AJ580596; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ580596;
XX
DT   12-AUG-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*29KAL0403
DE   allele, exon 2 and joined CDS
XX
KW   HLA-A gene; HLA-A*29KAL0403 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-AUG-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Alkharsah K.R., Elsner H.A., Dedicoat M., Schulz T.F., Blasczyk R.;
RT   "A new HLA-A*2902 variant";
RL   Unpublished.
XX
DR   MD5; 2ca421edacb586ba55167962d55e9dcf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="DNA#0283 MHH Virology"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa:Hlabisa, KwaZulu"
FT                   /tissue_type="saliva"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ580597.1:1..>276)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29KAL0403"
FT   CDS             join(<1..270,AJ580597.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29KAL0403"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*29:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q4A517"
FT                   /protein_id="CAE45179.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAPITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29KAL0403"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 85 C; 94 G; 37 T; 0 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcaccgt ggatagagca ggaggggccg gagtattggg       180
     acctgcagac acggaatgtg aaggcccagt cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//