Dbfetch

ID   AJ580501; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ580501;
XX
DT   12-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen B*4010 allele, exon 3
XX
KW   B*4010 allele; HLA-B gene; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (11-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Weschler B., Froelich N., Leisenbach R.;
RT   "Sequence of the HLA-B*4010 allele found in 2 two UCLA quality controls";
RL   Unpublished.
XX
DR   MD5; 31d4f0100d6385a32d5c4b90c46bcca2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4010"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*40:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YNX3"
FT                   /protein_id="CAE45171.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="B*4010"
FT                   /number=3
XX
SQ   Sequence 276 BP; 53 A; 85 C; 101 G; 37 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//