Dbfetch

ID   AJ580002; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ580002;
XX
DT   07-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, Cw*03new allele,
DE   exon 4
XX
KW   Cw*03new allele; HLA-C gene; human leucocyte antigen C;
KW   major histocompatibility complex, MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Weschler B., Leisenbach R.;
RT   "A new HLA-Cw*03 allele identical to the Cw*030401 allele except a silent
RT   punctual mutation in exon 4 at position 873";
RL   Unpublished.
XX
DR   MD5; c7f389515085f719586b9e7eb1de861a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*03:04:03"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YNY3"
FT                   /protein_id="CAE30460.1"
FT                   /translation="HPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=4
XX
SQ   Sequence 276 BP; 65 A; 80 C; 88 G; 43 T; 0 other;
     aacacccaaa gacacacgtg acccaccatc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagtgg gatggggagg       120
     accaaactca ggacactgag cttgtggaga ccaggccagc aggagatgga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacgtgc catgtgcagc       240
     acgaggggct gccagagccc ctcaccctga gatggg                                 276
//