spacer

EBI Dbfetch

ID   AJ580001; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ580001;
XX
DT   07-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, Cw*03new allele,
DE   exon 3
XX
KW   Cw*03new allele; HLA-C gene; human leucocyte antigen C;
KW   major histocompatibility complex, MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Weschler B., Leisenbach R.;
RT   "A new HLA-Cw*03 allele identical to the Cw*030401 allele except a silent
RT   punctual mutation in exon 4 at position 873";
RL   Unpublished.
XX
DR   MD5; 63ca60d7f37b3a880cf96bbbe1173a68.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000419135; homo_sapiens.
DR   Ensembl-Tr; ENST00000429840; homo_sapiens.
DR   Ensembl-Tr; ENST00000433153; homo_sapiens.
DR   Ensembl-Tr; ENST00000445075; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YNY4"
FT                   /db_xref="IMGT/HLA:C*03:04:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YNY4"
FT                   /protein_id="CAE30459.1"
FT                   /translation="SHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRA"
FT   exon            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=3
XX
SQ   Sequence 276 BP; 54 A; 82 C; 101 G; 39 T; 0 other;
     ggtctcacat catccagagg atgtatggct gcgacgtggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggatctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctgaagaa tgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer