spacer

EBI Dbfetch

ID   AJ580000; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ580000;
XX
DT   07-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, Cw*03new allele,
DE   exon 2
XX
KW   Cw*03new allele; HLA-C gene; human leucocyte antigen C;
KW   major histocompatibility complex, MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dormoy A.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Weschler B., Leisenbach R.;
RT   "A new HLA-Cw*03 allele identical to the Cw*030401 allele except a silent
RT   punctual mutation in exon 4 at position 873";
RL   Unpublished.
XX
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000419135; homo_sapiens.
DR   Ensembl-Tr; ENST00000429840; homo_sapiens.
DR   Ensembl-Tr; ENST00000433153; homo_sapiens.
DR   Ensembl-Tr; ENST00000445075; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
DR   Ensembl-Tr; ENST00000491984; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YNY5"
FT                   /db_xref="IMGT/HLA:C*03:04:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YNY5"
FT                   /protein_id="CAE30458.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEA"
FT   exon            <1..>270
FT                   /gene="HLA-C"
FT                   /allele="Cw*03new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 53 A; 83 C; 99 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer