spacer

EBI Dbfetch

ID   AJ579998; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ579998;
XX
DT   07-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, Cw*15new allele,
DE   exon 3
XX
KW   Cw*15new allele; HLA-C gene; human leucocyte antigen C;
KW   major histocompatibility complex, MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (05-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N.;
RT   "A new HLA-Cw*15 allele identical to the Cw*150501 allele except two silent
RT   punctual mutations in exon 4 at position 678 and 868";
RL   Unpublished.
XX
DR   MD5; 796f6dd3a71d1e103800816d11798bb9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YNY7"
FT                   /db_xref="IMGT/HLA:C*15:05:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YNY7"
FT                   /protein_id="CAE30456.1"
FT                   /translation="SHIIQRMYGCDLGPDGRLLRGHDQFAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="Cw*15new"
FT                   /number=3
XX
SQ   Sequence 276 BP; 53 A; 86 C; 101 G; 36 T; 0 other;
     ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggcatga ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer