spacer

EBI Dbfetch

ID   AJ579860; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ579860;
XX
DT   05-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15 allele,
DE   exon 4
XX
KW   HLA-B gene; HLA-B*3501 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (04-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 Rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N.;
RT   "A new HLA-B*15 allele identical to the B*150101 allele except a ponctual
RT   mutation in exon 2 at position 238";
RL   Unpublished.
XX
DR   MD5; 32d7c44dafe7b3bbb0bdb49708683b3d.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
DR   Ensembl-Tr; ENST00000416726; homo_sapiens.
DR   Ensembl-Tr; ENST00000418147; homo_sapiens.
DR   Ensembl-Tr; ENST00000425798; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*15:82"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP17"
FT                   /protein_id="CAE30300.1"
FT                   /translation="PPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 276 BP; 68 A; 84 C; 82 G; 42 T; 0 other;
     accccccaaa gacacatgtg acccaccacc ccatctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacaccgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//


spacer
spacer