spacer

EBI Dbfetch

ID   AJ579858; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ579858;
XX
DT   05-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15 allele,
DE   exon 2
XX
KW   HLA-B gene; HLA-B*3501 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dormoy A.;
RT   ;
RL   Submitted (04-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 Rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N.;
RT   "A new HLA-B*15 allele identical to the B*150101 allele except a ponctual
RT   mutation in exon 2 at position 238";
RL   Unpublished.
XX
DR   MD5; 98e53ff2b7f935198e249d1039a5e8f3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YP19"
FT                   /db_xref="IMGT/HLA:B*15:82"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP19"
FT                   /protein_id="CAE30298.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQERPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 59 A; 88 C; 87 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggagaggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer