spacer

EBI Dbfetch

ID   AJ579780; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AJ579780;
XX
DT   05-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*08
DE   new allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*08 new allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Mosebach M.;
RT   ;
RL   Submitted (01-AUG-2003) to the INSDC.
RL   Mosebach M., Department of Transplantation Immunology, Institute of
RL   Transfusion Medicine, RCBDS, Sandhof-Str. 1, Frankfurt am Main, 60528,
RL   GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00515.x.
RX   PUBMED; 16441489.
RA   Brixner V., Mosebach M., Schmidt M., Hermann S., Seifried E., Seidl C.;
RT   "HLA-DRB1*0826 and HLA-DQB1*0627, two novel class II alleles identified in
RT   blood stem cell donors of Caucasian origin";
RL   Tissue Antigens 67(2):160-162(2006).
XX
DR   MD5; bb17cdff72358d31fa248647138ad59c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="leucocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08 new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q70IU8"
FT                   /db_xref="IMGT/HLA:DRB1*08:26"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q70IU8"
FT                   /protein_id="CAE30289.1"
FT                   /translation="RFLEYSTGECYFFNGTERVLFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..269
FT                   /number=2
XX
SQ   Sequence 269 BP; 57 A; 63 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     tgttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcga                                         269
//


spacer
spacer