spacer

EBI Dbfetch

ID   AJ579653; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ579653;
XX
DT   01-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele HLA-A*02,
DE   exon 3
XX
KW   HLA-A gene; HLA-A*02 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Day S.;
RT   ;
RL   Submitted (31-JUL-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Goodman R., Day S., Bendukidza N.;
RT   "Identification A*02 variant allele with a nucleotide subtitution and
RT   coding change at a constant position";
RL   Unpublished.
XX
DR   MD5; 84a6125b6c8d9f6ade6dfbc450d521d8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YP22"
FT                   /db_xref="IMGT/HLA:A*02:67"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP22"
FT                   /protein_id="CAE22483.1"
FT                   /translation="SHTVQRMYGCDVGSDWRFLCGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=3
XX
SQ   Sequence 276 BP; 58 A; 78 C; 98 G; 42 T; 0 other;
     gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg cgcttcctct        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg gaggcggccc       180
     atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer