spacer

EBI Dbfetch

ID   AJ579652; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AJ579652;
XX
DT   01-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele HLA-A*02,
DE   exon 4
XX
KW   HLA-A gene; HLA-A*02 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Day S.;
RT   ;
RL   Submitted (31-JUL-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Goodman R., Day S., Bendukidza N.;
RT   "Identification A*02 variant allele with a nucleotide subtitution and
RT   coding change at a constant position";
RL   Unpublished.
XX
DR   MD5; 5132f239386a050fa2e47839a4a41d8a.
DR   Ensembl-Gn; ENSG00000227715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000413609; homo_sapiens.
DR   Ensembl-Tr; ENST00000438861; homo_sapiens.
DR   Ensembl-Tr; ENST00000453057; homo_sapiens.
DR   Ensembl-Tr; ENST00000453975; homo_sapiens.
DR   Ensembl-Tr; ENST00000455882; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   Ensembl-Tr; ENST00000547522; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>266
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentating molecule"
FT                   /db_xref="IMGT/HLA:A*02:67"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP23"
FT                   /protein_id="CAE22482.1"
FT                   /translation="APKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLT"
FT   exon            <1..>266
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=4
XX
SQ   Sequence 266 BP; 58 A; 82 C; 83 G; 43 T; 0 other;
     acgcccccaa aacgcatatg actcaccacg ctgtctctga ccatgaagcc accctgaggt        60
     gctgggccct gagcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg       120
     accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga accttccaga       180
     agtgggcggc tgtggtggtg ccttctggac aggagcagag atacacctgc catgtgcagc       240
     atgagggttt gcccaagccc ctcacc                                            266
//


spacer
spacer