spacer

EBI Dbfetch

ID   AJ579648; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ579648;
XX
DT   01-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene MHC class I antigen, HLA-Cw*12 allele, exon
DE   3
XX
KW   HLA-B gene; HLA-Cw*12 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (01-AUG-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 Rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N.;
RT   "A new Cw*12 allele identical to the Cw*120301 allele except a point
RT   mutation in exon 3 at position 368";
RL   Unpublished.
XX
DR   MD5; 078da463f93ada430165818a4dadcd05.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YP26"
FT                   /db_xref="IMGT/HLA:C*12:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP26"
FT                   /protein_id="CAE22467.1"
FT                   /translation="SHTLQWMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12"
FT                   /number=3
XX
SQ   Sequence 276 BP; 50 A; 87 C; 102 G; 37 T; 0 other;
     ggtctcacac cctccagtgg atgtctggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac tgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer