Dbfetch

ID   AJ579646; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ579646;
XX
DT   01-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene MHC class I antigen, HLA-Cw01new allele,
DE   exon 4
XX
KW   HLA-B gene; HLA-Cw01new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (31-JUL-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 Rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Weschler B.;
RT   ""A new Cw*01 allele identical to the Cw*0102 allele except a silent
RT   mutation in exon 4 at position 772";
RL   Unpublished.
XX
DR   MD5; c55070d4c8ca41d2da437a0d3209d2eb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw01new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*01:02:02"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP28"
FT                   /protein_id="CAE22465.1"
FT                   /translation="HPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVMVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw01new"
FT                   /number=4
XX
SQ   Sequence 276 BP; 64 A; 82 C; 88 G; 42 T; 0 other;
     aacacccaaa gacacacgtg acccaccatc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagtgg gatggggagg       120
     accaaactca ggacaccgag cttgtggaga cccggccagc aggagatgga accttccaga       180
     agtgggcagc tgtgatggtg ccttctggag aagagcagag atacacgtgc catgtgcagc       240
     acgaggggct gccggagccc ctcaccctga gatggg                                 276
//