Dbfetch

ID   AJ579645; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ579645;
XX
DT   01-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene MHC class I antigen, HLA-Cw01new allele,
DE   exon 3
XX
KW   HLA-B gene; HLA-Cw01new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (31-JUL-2003) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 Rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Weschler B.;
RT   "A new Cw*01 allele identical to the Cw*0102 allele except a silent
RT   mutation in exon 4 at position 772.";
RL   Unpublished.
XX
DR   MD5; 8e64c45c0472f035827f1b4012df6ae4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw01new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YP29"
FT                   /db_xref="IMGT/HLA:C*01:02:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP29"
FT                   /protein_id="CAE22464.1"
FT                   /translation="SHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            <1..>276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw01new"
FT                   /number=3
XX
SQ   Sequence 276 BP; 51 A; 88 C; 102 G; 35 T; 0 other;
     ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//