Dbfetch

ID   AJ579628; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AJ579628;
XX
DT   01-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen HLA-B*40 allele,
DE   exons 2 and 3
XX
KW   HLA-B gene; HLA-B*40 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Velickovic Z.M.;
RT   ;
RL   Submitted (29-JUL-2003) to the INSDC.
RL   Velickovic Z.M., Molecular Genetics, Tissue Typing, Australian Red Cross
RL   Blood Service, 153 Clarence Street, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.M.;
RT   "Novel HLA-B*40 allele";
RL   Unpublished.
XX
DR   MD5; 80ebced6bbc2c3654536948742287dc0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*40:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP30"
FT                   /protein_id="CAE22451.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=3
XX
SQ   Sequence 791 BP; 144 A; 262 C; 280 G; 105 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccga       360
     ccccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggact gggctgaccg cggggccggg gccagggtct cacaccctcc agaggatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc tcccagcgca agttggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggacaagct       780
     ggagcgcgct g                                                            791
//