spacer

EBI Dbfetch

ID   AJ575563; SV 1; linear; genomic DNA; STD; HUM; 789 BP.
XX
AC   AJ575563;
XX
DT   04-JUL-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*44 allele,
DE   exons 2-3
XX
KW   HLA-B gene; HLA-B*44 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-789
RA   Velickovic Z.M.;
RT   ;
RL   Submitted (04-JUL-2003) to the INSDC.
RL   Velickovic Z.M., Molecular Genetics, Tissue Typing, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovicc Z.M.;
RT   "Novel HLA-B*44 allele";
RL   Unpublished.
XX
DR   MD5; 78b399e33d976e353fe7adc0f97db549.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..789
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,514..789)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT   CDS             join(<1..270,514..>789)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YPH3"
FT                   /db_xref="IMGT/HLA:B*44:37:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YPH3"
FT                   /protein_id="CAE01414.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=2
FT   intron          271..513
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=2
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=3
XX
SQ   Sequence 789 BP; 143 A; 263 C; 281 G; 102 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       420
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       480
     gggggacggg gctgaccgcg gggccggggc cagggtctca catcatccag aggatgtacg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccaggac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       720
     tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcgg                                                               789
//


spacer
spacer