spacer

EBI Dbfetch

ID   AJ566950; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ566950;
XX
DT   18-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, HLA-Cw*0701
DE   allele, exon 3
XX
KW   HLA-Cw gene; HLA-Cw*0701 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dunn P.P.;
RT   ;
RL   Submitted (17-JUN-2003) to the INSDC.
RL   Dunn P.P., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.;
RT   "Nucleotide sequence of a HLA-Cw*0701 variant allele";
RL   Unpublished.
XX
DR   MD5; 523218765aceb724e763c40a60c0fc93.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..276
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0701"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0701"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YQ06"
FT                   /db_xref="IMGT/HLA:C*07:28"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ06"
FT                   /protein_id="CAD98751.1"
FT                   /translation="SHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0701"
FT                   /number=3
XX
SQ   Sequence 276 BP; 52 A; 84 C; 101 G; 39 T; 0 other;
     gttctcacac catccagagg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgcggcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcggat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer