spacer

EBI Dbfetch

ID   AJ566211; SV 1; linear; genomic DNA; STD; HUM; 3341 BP.
XX
AC   AJ566211;
XX
DT   11-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B for MHC class I antigen precursor, HLA-B*4805 variant
DE   allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*4805 variant allele; human leucocyte antigen B precursor;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3341
RA   Dunn P.P.;
RT   ;
RL   Submitted (09-JUN-2003) to the INSDC.
RL   Dunn P.P., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.P.J.;
RT   "Complete nucleotide sequence of a HLA-A*4805 variant allele";
RL   Unpublished.
XX
DR   MD5; 491b5bc2fc9ce9cb290b9ccb4ee6e3ee.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3341
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(303..375,504..773,1019..1294,1869..2144,2238..2354,
FT                   2795..2827,2935..2978)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /product="MHC class I antigen precursor"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6KEQ1"
FT                   /db_xref="IMGT/HLA:B*48:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6KEQ1"
FT                   /protein_id="CAD92861.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   sig_peptide     303..375
FT                   /gene="HLA-B"
FT   exon            <303..375
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=1
FT   intron          376..503
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=1
FT   mat_peptide     join(504..773,1019..1294,1869..2144,2238..2354,2795..2827,
FT                   2935..2978)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=2
FT   intron          774..1018
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=2
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=3
FT   intron          1295..1868
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=3
FT   exon            1869..2144
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=4
FT   intron          2145..2237
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=4
FT   exon            2238..2354
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=5
FT   intron          2355..2794
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=5
FT   exon            2795..2827
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=6
FT   intron          2828..2934
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=6
FT   exon            2935..2978
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4805 variant allele"
FT                   /number=7
XX
SQ   Sequence 3341 BP; 619 A; 963 C; 1055 G; 704 T; 0 other;
     ttggtgtagg agaagaggga tcaggacgaa gtcccaggtc ccggacgggg ctctcagggt        60
     ctcaggctcc gagggccgcg tctgcaatgg ggaggcgcag cgttggggat tccccactcc       120
     cctgagtttc acttcttctc ccaacttgtg tcgggtcctt cttccaggat actcgtgacg       180
     cgtccccact tcccactccc attgggtatt ggatatctag agaagccaat cagcgtcgcc       240
     gcggtcccag ttctaaagtc cccacgcacc cacccggact cagagtctcc tcagacgccg       300
     agatgctggt catggcgccc cgaaccgtcc tcctgctgct ctcggcggcc ctggccctga       360
     ccgagacctg ggccggtgag tgcgggtcgg gagggaaatg gcctctgccg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacctga ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcacccc caggctccca ctccatgagg tatttctaca cctccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacccagtt       600
     cgtgaggttc gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac       720
     ttaccgagag agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcctccctg aggccgcggg acccgcccag accctcgacc       900
     ggcgagagcc ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg       960
     ggttggtcgg ggcggggcgg ggctcggggg actgggctga ccgcggggcc ggggccaggg      1020
     tctcacaccc tccagagcat gtacggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggcatgacc agtacgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc      1140
     tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gaggcggagc agcggagagc ctacctggag ggcgagtgcg tggagtggct ccgcagatac      1260
     ctggagaacg ggaaggacaa gctggagcgc gctggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccg ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta gacaattaag gaatgacgtc tctgaggaaa tggaggggaa      1500
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1560
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1620
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1680
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1740
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1800
     acatgggtgg tcctagggtg tcccatgaaa gatgcaaagc gcctgaattt tctgactctt      1860
     cccatcagac cccccaaaga cacacgtgac ccaccacccc atctctgacc atgaggccac      1920
     cctgaggtgc tgggccctgg gtttctaccc tgcggagatc acactgacct ggcagcggga      1980
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      2040
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      2100
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      2160
     ggggtcatat ctcttctcag ggaaagcagg agcccttcag cagggtcagg gcccctcatc      2220
     ttcccctcct ttcccagagc cgtcttccca gtccaccgtc cccatcgtgg gcattgttgc      2280
     tggcctggct gtcctagcag ttgtggtcat cggagctgtg gtcgctgctg tgatgtgtag      2340
     gaggaagagt tcaggtaggg aaggggtgag gggtggggtc tgggttttct tgtcccactg      2400
     gggtttcaag ccccaggtag aagtgttccc tgcctcatta ctgggaagca gcatgcacac      2460
     aggggctaac gcagcctggg accctgtgtg ccagcactta ctcttttgtg cagcacatgt      2520
     gacaatgaag gatggatgta tcaccttgat ggttgtggtg ttggggtcct gattccagca      2580
     ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag ttggtccagg      2640
     acccacactt gctttcctcg tgtttcctga tcctgccctg ggtctgtagt catacttctg      2700
     gaaattcctt ttgggtccaa gactaggagg ttcctctaag atctcatggc cctgcttcct      2760
     cccagtgccc tcacaggaca ttttcttccc acaggtggaa aaggagggag ctactctcag      2820
     gctgcgtgta agtggtgggg gtgggagtgt ggaggagctc acccacccca taattcctcc      2880
     tgtcccacgt ctcctgcggg ctcttgacca ggtcctgttt ttgttctact ccaggcagcg      2940
     acagtgccca gggctctgat gtgtctctca cagcttgaaa aggtgagatt cttggggtct      3000
     agagtgggtg gggtggcggg tctgggggtg ggtggggcag aggggaaagg cctgggtaat      3060
     ggggattctt tgattgggat gtttcgcgtg tgtggtgggc tgtttagagt gtcatcgctt      3120
     accatgacta accagaattt gttcatgact gttgttttct gtagcctgag acagctgtct      3180
     tgtgagggac tgagatgcag gatttcttca cgcctcccct ttgtgacttc aagagcctct      3240
     ggcatctctt tctgcaaagg cacctgaatg tgtctgcgtc cctgttagca taatgtgagg      3300
     aggtggagag acagcccacc cttgtgtcca ctgtgacccc t                          3341
//


spacer
spacer