spacer

EBI Dbfetch

ID   AJ566209; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ566209;
XX
DT   11-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*0701new, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*0701new allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cox S.T.;
RT   ;
RL   Submitted (09-JUN-2003) to the INSDC.
RL   Cox S.T., Dept. HLA sequencing, Anthony Nolan Research Institute, The Royal
RL   Free Hospital, Pond Street, Hampstead, London, UNITED KINGDOM.
XX
RN   [2]
RA   Dunne C.;
RT   "A new DRB1 allele";
RL   Unpublished.
XX
DR   MD5; 12838f3e8261920fbbfc9cf80c8be051.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0701new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YQ35"
FT                   /db_xref="IMGT/HLA:DRB1*07:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ35"
FT                   /protein_id="CAD92860.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQEEVVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DBR1"
FT                   /allele="HLA-DRB1*0701new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 101 G; 48 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg aggaggtcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer