spacer

EBI Dbfetch

ID   AJ566139; SV 2; linear; genomic DNA; STD; HUM; 3409 BP.
XX
AC   AJ566139;
XX
DT   11-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen precursor, HLA-A*02/A*32
DE   recombinant variant allele, exons 1-8
XX
KW   HLA-A gene; HLA-A*02/A*32 recombinant variant allele;
KW   human leucocyte antigen A; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Carter V.;
RT   ;
RL   Submitted (04-JUN-2003) to the INSDC.
RL   Carter V., H & I, National Blood Service, Holland Drive, Barrack Road,
RL   Newcastle upon Tyne, NE2 4NQ, UNITED KINGDOM.
XX
RN   [2]
RA   Carter V., Dunn P., Cavanagh G.;
RT   "Identification of a novel recombinant HLA-A*02/*32 allele by serology and
RT   PCR-SSP typing and characterization by sequencing based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-3409
RA   Carter V.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Carter V., H & I, National Blood Service, Holland Drive, Barrack Road,
RL   Newcastle upon Tyne, NE2 4NQ, UNITED KINGDOM.
XX
DR   MD5; 4623b3028e74f4d68e23c831bc718185.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3409
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(320..392,523..792,1034..1309,1910..2185,2285..2401,
FT                   2843..2875,3018..3065,3235..3239)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /product="MHC class I antigen precursor"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YQ33"
FT                   /db_xref="IMGT/HLA:A*02:65"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ33"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD97419.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAMFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   sig_peptide     320..391
FT                   /gene="HLA-A"
FT   exon            <320..392
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=1
FT   mat_peptide     392..3236
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          393..522
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=1
FT   exon            523..792
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=2
FT   intron          793..1033
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=2
FT   exon            1034..1309
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=3
FT   intron          1310..1909
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=3
FT   exon            1910..2185
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=4
FT   intron          2186..2284
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=4
FT   exon            2285..2401
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=5
FT   intron          2402..2842
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=5
FT   exon            2843..2875
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=6
FT   intron          2876..3017
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=6
FT   exon            3018..3065
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=7
FT   intron          3066..3234
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=7
FT   exon            3235..>3239
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02/A*32 recombinant variant"
FT                   /number=8
XX
SQ   Sequence 3409 BP; 650 A; 975 C; 1054 G; 730 T; 0 other;
     tgagacagag cgcttggcac agaagcagag gggtcagggc gaagtcccag ggccccaggc        60
     gtggctctca gggtctcagg ccccgaaggc ggtgtatgga ttggggagtc ccagccttgg       120
     ggattcccca actccgcagt ttcttttctc cctctcccaa cctatgtagg gtccttcttc       180
     ctggatactc acgacgcgga cccagttctc actcccattg ggtgtcgggt ttccagagaa       240
     gccaatcagt gtcgtcgcgg tcgcggttct aaagtccgca cgcacccacc gggactcaga       300
     ttctccccag acgccgagga tggccgtcat ggcgccccga accctcgtcc tgctactctc       360
     gggggctctg gccctgaccc agacctgggc gggtgagtgc ggggtcggga gggaaacggc       420
     ctctgtgggg agaagcaacg ggcccgcctg gcgggggcgc aggacccggg aagccgcgcc       480
     gggaggaggg tcgggcgggt ctcagccact cctcgtcccc aggctctcac tccatgaggt       540
     atttcttcac atccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gcagtgggct       600
     acgtggacga cacgcagttc gtgcggttcg acagcgacgc cgcgagccag aggatggagc       660
     cgcgggcgcc gtggatagag caggagggtc cggagtattg ggacggggag acacggaaag       720
     tgaaggccca ctcacagact caccgagtgg acctggggac cctgcgcggc tactacaacc       780
     agagcgaggc cggtgagtga ccccggcccg gggcgcaggt cacgacctct catcccccac       840
     ggacgggcca ggtcgcccac agtctccggg tccgagatcc accccgaagc cgcgggaccc       900
     cgagaccctt gccccgggag aggcccaggc gcctttaccc ggtttcattt tcagtttagg       960
     ccaaaaatcc ccccgggttg gtcggggccg gacggggctc gggggactgg gctgaccgtg      1020
     gggtcggggc caggttctca caccatccag atgatgtatg gctgcgacgt ggggccggac      1080
     gggcgcctcc tccgcgggta ccagcaggac gcctacgacg gcaaggatta catcgccttg      1140
     aacgaggacc tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag      1200
     tgggaggcgg cccgtgtggc ggagcagttg agagcctacc tggagggcac gtgcgtggag      1260
     tggctccgca gatacctgga gaacgggaag gagacgctgc agcgcacggg taccaggggc      1320
     cacggggcgc ctccctgatc gcctgtagat ctcccgggct ggcctcccac aaggagggga      1380
     gacaattggg accaacacta gaatatcgcc ctccctctgg tcctgaggga gaggaatcct      1440
     cctgggtttc cagatcctgt accagagagt gactctgagg ttccgccctg ctctctgaca      1500
     caattaaggg ataaaatctc tgaaggaatg acgggaagac gatccctcga atactgatga      1560
     gtggttccct ttgacacaca ccggcagcag ccttgggccc gtgacttttc ctctcaggcc      1620
     ttgttctctg cttcacactc aatgtgtgtg ggggtctgag tccagcactt ctgagtccct      1680
     cagcctccac tcaggtcagg accagaagtc gctgttccct cttcagggac tagaattttc      1740
     cacggaatag gagattatcc caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc      1800
     ccttccccat cccaggtgtc ctgtccattc tcaagatagc cacatgtgtg ctggaggagt      1860
     gtcccatgac agatgcaaaa tgcctgaatg ttctgactct tcctgacaga cgcccccaag      1920
     acgcatatga ctcaccacgc tgtctctgac catgaggcca ccctgaggtg ctgggccctg      1980
     agcttctacc ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag      2040
     gacacggagc ttgtggagac caggcctgca ggggatggaa ccttccagaa gtgggcgtct      2100
     gtggtggtgc cttctggaca ggagcagaga tacacctgcc atgtgcagca tgagggtctg      2160
     cccaagcccc tcaccctgag atggggtaag gagggagatg ggggtgtcat gtcttttacg      2220
     gaaagcagga gcctctctga cctttagcag ggtcagggcc cctcaccttc ccctcttttc      2280
     ccagagccgt cttcccagcc caccatcccc atcgtgggca tcattgctgg cctagttctc      2340
     tttggagcta tgttcgctgg agctgtggtc gctgctgtga ggtggaggag gaagagctca      2400
     ggtggggtga agggatgaag ggtggggtct gagatttctt gtctcactga gggttccaag      2460
     acccaggtag aagtgtgccc tgcctcgtta ctgggaagca ccatccacaa ttatgggcct      2520
     acccagcctg ggccctgtgt gccagcactt actcttttgt aaagcacctg ttaaaatgaa      2580
     ggacagattt atcaccttga ttacggcggt gatgggacct gatcccagca gtcacaagtc      2640
     acaggggaag gtccctgagg accttcagga gggcggttgg tccaggaccc acacctgctt      2700
     tcttcatgtt tcctgatccc gccctgggtc tgcagtcaca catttctgga aacttctctg      2760
     aggtccaaga cttggaggtt cctctaggac cttaaggccc tggctccttt ctggtatctc      2820
     acaggacatt ttcttcccac agatagaaaa ggagggagct actctcaggc tgcaagtaag      2880
     tatgaaggag gctgatgcct gaggtccttg ggatattgtg tttgggagcc cgtgggggag      2940
     ctcacccacc ccacaattcc tcctctagcc acatcttctg tgggatctga ccaggttctg      3000
     tttttgtcct accccaggca gtgacagtgc ccagggctct gatatgtctc tcacagcttg      3060
     taaaggtgag agcctggagg gcctgatgtg tgttgggtgt tgggcggaac agtggacgca      3120
     gctgtgctat ggggtttctt tgcattggat gtattgagca tgcgatgggc tgtttaaagt      3180
     gtgactcctc actgtgacag atacgaattt gttcatgaat atttttttct atagtgtgag      3240
     acagctgcct tgtgtgggac tgagaggcaa gatttgttcc tgcccttccc tttgtgactt      3300
     gaagaaccct gactttgttt ctgcaaaggc acctgcatgt gtctgtgttc ttgtaggcat      3360
     aatgtgagga ggtggggaga ccaccccacc cccatgtcca ccatgaccc                  3409
//


spacer
spacer