spacer

EBI Dbfetch

ID   AJ564994; SV 2; linear; genomic DNA; STD; HUM; 3408 BP.
XX
AC   AJ564994;
XX
DT   05-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*3307 allele, exons
DE   1-8
XX
KW   HLA-A gene; HLA-A*3307 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Dunn P.P.;
RT   ;
RL   Submitted (03-JUN-2003) to the INSDC.
RL   Dunn P.P., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.P.J.;
RT   "Complete nucleotide sequence of HLA-A*3307";
RL   Unpublished.
XX
RN   [3]
RP   1-3408
RA   Dunn P.P.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Dunn P.P., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, BS10 5ND, UNITED KINGDOM.
XX
DR   MD5; 7df8f80927df5172c33944a3981214f1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3408
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<320..392,522..791,1033..1308,1909..2184,2284..2400,
FT                   2841..2873,3016..3063,3233..3237)
FT                   /gene="HLA-A*33"
FT                   /allele="A*3307"
FT   CDS             join(320..392,522..791,1033..1308,1909..2184,2284..2400,
FT                   2841..2873,3016..3063,3233..3237)
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YP31"
FT                   /db_xref="IMGT/HLA:A*33:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP31"
FT                   /protein_id="CAD92641.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVEEQLRAYLEGTCVEWLRRHLENGKETLQRTDPPRTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   sig_peptide     320..392
FT                   /gene="HLA-A*33"
FT   exon            <320..392
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=1
FT   intron          393..521
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=1
FT   exon            522..791
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=2
FT   intron          792..1032
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=2
FT   exon            1033..1308
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=3
FT   intron          1309..1908
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=3
FT   exon            1909..2184
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=4
FT   intron          2185..2283
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=4
FT   exon            2284..2400
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=5
FT   intron          2401..2840
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=5
FT   exon            2841..2873
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=6
FT   intron          2874..3015
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=6
FT   exon            3016..3063
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=7
FT   intron          3064..3232
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=7
FT   exon            3233..3237
FT                   /gene="HLA-A*33"
FT                   /allele="HLA-A*3307"
FT                   /number=8
XX
SQ   Sequence 3408 BP; 654 A; 979 C; 1046 G; 728 T; 1 other;
     tgagacagag cgcttggcac aggagcagag gggtcagggc gaagtcccag ggccccaggc        60
     gtggctctca gggtctcagg ccccgaaggc ggtgtatgga ttggggagtc ccagccttgg       120
     ggattcccca actccgcagt ttcttttctc cctctcccaa cctatgtagg gtccttcttc       180
     ctggatactc acgacgcgga cccagttctc actcccattg ggtgtcgggt ttccagagaa       240
     gccaatcagt gtcgtcgcgg tcgcggttct aaagtccgca cgcacccrcc gggactcaga       300
     ttctccccag acgccgagga tggccgtcat ggcgccccga accctcctcc tgctactctt       360
     gggggccctg gccctgaccc agacctgggc gggtgagtgc ggggtcgtgg ggaaaccgcc       420
     tctgcgggga gaagcaaggg gcccgcccgg cgggggcgca ggacccgggt agccgcgccg       480
     ggaggagggt cgggcggatc tcagccactc ctcgccccca ggctcccact ccatgaggta       540
     tttcaccaca tccgtgtccc ggcccggccg cggggagccc cgcttcatcg ccgtgggcta       600
     cgtggacgac acgcagttcg tgcggttcga cagcgacgcc gcgagccaga ggatggagcc       660
     gcgggcgccg tggatagagc aggaggggcc ggagtattgg gaccggaaca cacggaatgt       720
     gaaggcccac tcacagattg accgagtgga cctggggacc ctgcgcggct actacaacca       780
     gagcgaggcc ggtgagtgac cccagcccgg ggcgcaggtc acgacctctc atcccccacg       840
     gacgggccag gtcacccaca gtctccgggt ccgagatcca ccccgaagcc gcgggacccc       900
     gagacccttg ccccgggaga ggcccaggcg cctttacccg gtttcatttt cagtttaggc       960
     caaaaatccc cccgggttgg tcggggccgg acggggctcg ggggactggg ctgaccgtgg      1020
     ggtcggggcc aggttctcac accatccaga tgatgtatgg ctgcgacgtg gggtcggacg      1080
     ggcgcttcct ccgcgggtac cagcaggacg cctacgacgg caaggattac atcgccttga      1140
     acgaggacct gcgctcttgg accgcggcgg acatggcggc tcagatcacc cagcgcaagt      1200
     gggaggcggc ccgtgtggag gagcagttga gagcctacct ggagggcacg tgcgtggagt      1260
     ggctccgcag acacctggag aacgggaagg agacgctgca gcgcacgggt accaggggcc      1320
     acggggcgcc tccctgatcg cctgtagatc tcccgggctg gcctcccaca aggaggggag      1380
     acaattggga ccaacactag aatatcaccc tccctctggt cctgagggag aggaatcctc      1440
     ctgggtttcc agatcctgta ccagagagtg actctgaggt tccgccctgc tctgtgacac      1500
     aattaaggga taaaatctct gaaggaatga cgggaagacg atccctcgaa tactgatgag      1560
     tggttccctt tgacacacac cggcagcagc cttgggcccg tgacttttcc tctcaggcct      1620
     tgttctctgc ttcacactca atgtgtgtgg gggtctgagt ccagcacttc tgagtccctc      1680
     agcctccact caggtcagga ccagaagtcg ctgttccctc ttcagggact agaattttcc      1740
     acggaatagg agattatccc aggtgcctgt gtccaggctg gtgtctgggt tctgtgctcc      1800
     cttccccatc ccaggtgtcc tgtccattct caagatagcc acatgtgtgc tggaggagtg      1860
     tcccattaca gatgcaaaat gcctgaatgt tctgactctt cctgacagac ccccccagga      1920
     cgcatatgac tcaccacgct gtctctgacc atgaggccac cctgaggtgc tgggccctga      1980
     gcttctaccc tgcggagatc acactgacct ggcagcggga tggggaggac cagacccagg      2040
     acacggagct cgtggagacc aggcctgcag gggatggaac cttccagaag tgggcgtctg      2100
     tggtggtgcc ttctggacag gagcagagat acacctgcca tgtgcagcat gagggtctcc      2160
     ccaagcccct caccctgaga tggggtaagg agggagatgg gggtgtcatg tcttttaggg      2220
     aaagcaggag cctctctgac ctttagcagg gtcagggccc ctcaccttcc cctcttttcc      2280
     cagagccgtc ttcccagccc accatcccca tcgtgggcat cattgctggc ctagttctct      2340
     ttggagctgt gttcgctgga gctgtggtcg ctgctgtgag gtggaggagg aagagctcag      2400
     gtggggtgaa ggggtgaagg gtgggtctga gatttcttgt ctcactgagg gttccaagac      2460
     ccaggtagaa gtgtgccctg cctcgttact gggaagcacc atccacaatt atgggcctac      2520
     ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa agcacctgtt aaaatgaagg      2580
     acagatttat caccttgatt atggcggtga tgggacctga tcccagcagt cacaagtcac      2640
     aggggaaggt ccctgaggac cttcaggagg gcggttggtc caggacccac acctgctttc      2700
     ttcatgtttc ctgatcccgc cctgggtctg cagtcacaca tttctggaaa cttctctgag      2760
     gtccaagact tggaggttcc tctaggacct taaggccctg gctcctttct ggtatctcac      2820
     aggacatttt cttcccacag atagaaaagg agggagctac tctcaggctg caagtaagta      2880
     tgaaggagga tgatccaaga aatcactggg atattgtgtt tgggagcccg tgggggagct      2940
     cacccacccc acaattcctc ctctagccac atcttctgtg ggatctgacc aggttctgtt      3000
     tttgtcctac cccaggcagt gacagtgccc agggctctga tatgtctctc acagcttgta      3060
     aaggtgagag cctggagggc ctgatgtgtg ttgggtgttg ggcggaacag tggacgcagc      3120
     tgtgctatgg ggtttctttg cattggatgt attgagcatg cgatgggctg tttaaagtgt      3180
     gactcctcac tgtgacagat acgaatttgt tcatgaatat ttttttctat agtgtgagac      3240
     agctgccttg tgtgggactg agaggcaaga tttgttcctg cccttccctt tgtgacttga      3300
     agaaccctga ctttgtttct gcaaaggcac ctgcatgtgt ctgtgttctt gtaggcataa      3360
     tgtgaggagg tggggagacc accccacccc catgtccacc atgaccct                   3408
//


spacer
spacer