Dbfetch

ID   AJ564721; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AJ564721;
XX
DT   05-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*1518var
DE   allele, exons 2 and 3
XX
KW   HLA-B gene; HLA-B*1518var allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Tiercy J.M.;
RT   ;
RL   Submitted (27-MAY-2003) to the INSDC.
RL   Tiercy J.M., University Hospital of Geneva, Transplantation Immunology
RL   Unit/LNRH, 24 rue Micheli-du-Crest, 1211 Geneva 14, SWITZERLAND.
XX
RN   [2]
RA   Kervaire B., Zanone R., Tiercy J.M.;
RT   "Sequence of a new allele within the HLA-B15 serotype";
RL   Unpublished.
XX
DR   MD5; 62ab69dff7c7a7f0698731bb545be85b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /isolate="GR1202"
FT                   /serotype="HLA-B15"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-A*2402, A*2601, B*1518var, B*5101, Cw*0701,
FT                   Cw*14, DRB1*0801"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518var"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518var"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation to T cells"
FT                   /db_xref="GOA:Q70LX5"
FT                   /db_xref="IMGT/HLA:B*15:80"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q70LX5"
FT                   /protein_id="CAD92345.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518var"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518var"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518var"
FT                   /number=3
XX
SQ   Sequence 791 BP; 144 A; 260 C; 284 G; 103 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcctggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgagg ccgcgggacc cgcccaaacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggccggg gccagggtct cacatcatcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//